Get Quotes Contact Us My Profile Add Your Business

Connect with Top-Rated Auto Repair Shops in Dallas!

Read verified customer reviews of the most reliable auto repair shops in Dallas, TX. Save time and money by comparing prices, getting expert recommendations, and finding the perfect fit for your needs.

Find businesses near you
1st Choice Auto Glass

1st Choice Auto Glass

windshieldreplacementmckinney.com
1st Choice Auto Glass provides high-quality OEM auto glass and windshield replacement services in McKinney, TX, for all vehicle makes and models. We specialize in windshield repair and replacement, as well as mobile auto glass service. Our experienced technicians are fully trained and equipped with the latest technology to replace your windshield with a factory-quality installation. We offer a lifetime warranty on labor and same-day service. Make an appointment today!
The majority of reviewers had a positive experience with First Choice Glass Service, citing ease of scheduling, professional service, and excellent communication.
5.0
Based on 335 reviews
Profile Website Phone
Service Excellence Collision Repair Center

Service Excellence Collision Repair Center

secrc.com
Service Excellence Collision Repair Center provides excellent collision repair services in Dallas, Texas. With over 45 years of combined experience in the automotive industry, our team of experts uses state-of-the-art technology and techniques to deliver high-quality repairs. Our goal is to provide exceptional customer service, precise workmanship, and a lifetime warranty on all our repairs. We offer a range of services, including auto body repair, paintless dent repair, and auto body refinishing. Our team is committed to treating each customer like family and striving for excellence in every aspect of our business.
The customers have had excellent experiences with Service Excellence Collision Repair Center, praising their exceptional service, quality work, and friendly staff.
5.0
Based on 273 reviews
Profile Website Phone
Value Collision

Value Collision

valuecollision.com
At Value Collision, we take pride in our ability to take care of all of our customers' auto body repair needs. With a relaxing lounge area and complimentary snacks and beverages, we provide a comfortable experience for our customers. Our team of professionals is dedicated to providing high-quality repairs, from minor dents to major frame repairs, with a focus on customer satisfaction. We are the premier auto body repair shop in Dallas, offering a range of services including auto body repair, collision repair, hail damage repair, and more. With our commitment to customer satisfaction and our team's expertise, we are the go-to destination for auto body repair needs in the Dallas area.
The reviewers praise Value Collision for its honesty, integrity, excellent customer service, and high-quality repairs.
5.0
Based on 103 reviews
Profile Website Phone
Dallas Auto Paint

Dallas Auto Paint

dallasautopaint.com
At Dallas Auto Paint, our team of expert technicians are dedicated to providing top-quality auto body repair services. We specialize in accident repair, hail damage repair, and paint job services. With over 25 years of experience, we're dedicated to ensuring that your vehicle is returned to its original factory-finish condition. From dent repair to frame repair, we offer a wide range of services to get your car looking and running like new. Our team is equipped with state-of-the-art technology and a commitment to customer satisfaction. Whether you're dealing with minor dings or major damages, we've got you covered.
The body shop provided exceptional service, expertise, and attention to detail, resulting in a flawless repair.
5.0
Based on 4 reviews
Profile Website Phone
Mister Glass

Mister Glass

misterglassinc.com
Mister Glass is a well-established company with over 60 years of experience in providing on-site auto glass repair and replacement services. Our mobile service guarantees that customers can schedule their repairs at a time and place that is convenient for them. In addition to auto glass services, we also offer residential and commercial glass repair and replacement services. Our skilled technicians can repair and replace glass for a variety of applications, including windshields, windows, and mirrors. Our commitment to excellence has earned us a 5-star rating with over 1,900 reviews on Google, Facebook, Yelp, and Angi.
The reviewers praised Mister Glass for its exceptional service, friendly staff, and fast and efficient repairs.
4.9
Based on 1,925 reviews
Profile Website Phone
Dallas Auto Body Repair

Dallas Auto Body Repair

dallasautobodyrepair.com
Dallas Auto Body Repair is a reputable and experienced auto body repair service with over 20 years of experience. We take pride in providing quality service and exceeding our customers' expectations. Our team of experts is dedicated to providing top-notch workmanship, from small repairs to full restorations. We repair all types of vehicles, from cars to trucks, and offer a range of services, including collision repair, painting, and detailing. Our team is committed to providing exceptional customer service, professional communication, and a commitment to excellence.
Customers praise Dallas Auto Body Repair for its professionalism, excellent work quality, and outstanding customer service.
4.9
Based on 491 reviews
Profile Website Phone
A & M Glass Service

A & M Glass Service

amglassservice.com
A&M Glass Service is a family-owned business offering auto glass repair and replacement services. With 18 years of experience, we provide in-shop and mobile services, specializing in insurance claims. Our certified technicians offer same-day service with a lifetime workmanship warranty. We cater to the Dallas area, including Frisco, Grapevine, Duncanville, Rockwall, and surrounding cities.
Excellent customer service, quality of work, and pricing have earned A&M Glass Service high praise from satisfied customers.
4.9
Based on 89 reviews
Profile Website Phone
Low Price Auto Glass

Low Price Auto Glass

faithautoglassdallas.com
As a family-owned and operated Dallas auto glass repair shop, we understand the frustration of dealing with unexpected auto glass damage. Our mission is to help you find the best solution for your damaged windshield or auto glass. We take pride in our expertly trained technicians, providing high-quality repairs and replacements at affordable prices. We also offer low-cost insurance claims processing and lifetime warranties on our work. Whether you need windshield replacement, power window repair, or general auto glass repair, we're here to help. At Faith Auto Glass, we value our customers and strive to provide exceptional service to the Dallas community.
The reviews praise the company's professional and courteous service, fast turnaround, and competitive prices, among other positive attributes.
The only negative comment mentioned a slight issue with whistling heard on the first windshield replacement attempt, but this issue was resolved by ordering a new glass at no extra cost.
4.8
Based on 559 reviews
Profile Website Phone
FastGlass Windshield Repair

FastGlass Windshield Repair

fastglassdallas.com
FastGlass Windshield Repair & Replacement provides mobile windshield repair and replacement services in Dallas, Texas, specializing in chip repairs, auto glass replacement, and Advanced Driver Assistance Systems (ADAS) calibration. With a team of experienced technicians, we guarantee a lifetime warranty on all our services.
FastGlass has received praise for their excellent service, professionalism, and attention to detail.
FastGlass has received criticism for poor customer service and poor workmanship.
4.8
Based on 163 reviews
Profile Website Phone
White's

White's

whitescollision.com
At White's Collision Service, the safety of your vehicle is our top priority. When you work with our certified collision repair center, you get the highest quality repairs possible. We are a technology-forward auto body shop, utilizing the most advanced tools and methods available. We pride ourselves on our customer service and convenience to you, and we will outperform the competition every time! When you work with White's Collision Service, you will be happy with the results, and we'll do everything we can to make the process easy.
The reviewers praised White's for their high-quality repairs, professionalism, excellent customer service, and friendly and professional staff.
4.8
Based on 119 reviews
Profile Website Phone
Mvp Auto Collision

Mvp Auto Collision

mvpautobody.com
At MVP Auto Collision, our team of highly qualified technicians offers auto body, auto paint, and dent repair services. We pride ourselves on providing the highest quality services in the greater DFW area. With over 80 years of experience in the industry, our technicians are certified and specifically trained to provide reliable auto body, auto paint, and dent repair services. We strive to provide our customers with quality and efficient work, offering a lifetime warranty with all services. As a local, family-owned auto collision repair center, we take pride in providing services that get your car back on the road quickly and efficiently.
Positive comments praise the excellent customer service, timely repair, and high-quality work.
The only negative comment was about tape residue left on a customer's vehicle.
4.8
Based on 87 reviews
Profile Website Phone
Blanco's Flawless

Blanco's Flawless

blancosflawlessauto.com
Blanco's Flawless Auto is a family-owned business providing exceptional auto repair and maintenance services in Carrollton, TX. Our knowledgeable technicians and service writers are dedicated to delivering flawless service, whether you need a major repair or routine maintenance. We offer flexible scheduling options, unbeatable prices, and a range of amenities to ensure a comfortable and convenient experience. With over 30 years of experience, our team is committed to maintaining top-notch repair services, quality workmanship, and business integrity.
Reviewers praised Blanco's Auto for their excellent service, honesty, professionalism, and fair pricing.
4.8
Based on 81 reviews
Profile Website Phone
iCandy Auto Body

iCandy Auto Body

icandyautobody.com
At iCandy Auto Body, we specialize in Auto Paint and Auto Body Repair, offering a wide range of services including auto body paint restoration, bumper repair, and collision repair. Our expert technicians use the latest equipment and techniques to restore your vehicle to its original condition. We pride ourselves on our quality craftsmanship, customer satisfaction, and convenience. Our team is committed to providing a seamless and hassle-free experience for our customers. From minor scratches to major collision repairs, we handle it all.
The reviewers praised the exceptional customer service, attention to detail, and high-quality work provided by iCandy Auto Body.
4.8
Based on 54 reviews
Profile Website Phone
Valley View Car Care Center

Valley View Car Care Center

valleyviewcarcare.net
Valley View Car Care is a trusted auto repair shop in Farmers Branch, Texas, offering a range of services including brake repair, cooling system repair, steering and suspension repair, and more. With over 30 years of experience, our team of experts is dedicated to providing exceptional service and ensuring complete customer satisfaction.
Valley View Car Care is praised for their professional and courteous staff, fair pricing, and timely service.
Some reviewers experienced issues with communication, work quality, and customer service.
4.7
Based on 475 reviews
Profile Website Phone
Snappee Auto Care

Snappee Auto Care

snappeeautorepair.com
Snappee Auto Care is a full-service auto repair center providing high-quality car and truck repairs, oil changes, and inspections in the Dallas area since 1992. Our team of ASE-certified technicians offers a comprehensive range of auto maintenance and repair services, including oil changes, tune-ups, brake repairs, transmission flushes, state inspections, tire rotations, and trip/pre-purchase inspections.
Excellent customer service, friendly and trustworthy staff, efficient and quick repair work, and honest representation.
Prices were a bit high.
4.7
Based on 121 reviews
Profile Website Phone
Hackler Transmission

Hackler Transmission

hacklertransmission.com
Hackler Transmission is a trusted transmission repair and rebuild specialist serving the Dallas/Fort Worth area since 1958. We service all makes and models, including automatic and manual transmissions, and offer free computer diagnostics, free towing with major repairs, and financing options. Our certified technicians and state-of-the-art equipment ensure a quick and correct repair. We recommend servicing your transmission every 20,000 miles to ensure long vehicle life. Call us today at 972-243-4022 to schedule a service.
The reviewers praised the team's professionalism, expertise, honesty, and exceptional customer service, highlighting the high-quality service and fair pricing.
4.7
Based on 86 reviews
Profile Website Phone
Collision Rescue

Collision Rescue

collisionrescue.com
Collision Rescue is a family-owned-and-operated business that provides collision repair, auto detailing, and restorations for customers in Dallas, Texas. With over 30 years of experience in the industry, our team of skilled technicians is committed to fixing your car quickly and efficiently while maintaining the highest standards of quality and customer satisfaction. We work with all makes and models, and offer competitive pricing and a lifetime warranty on all repairs. In addition to collision repair, we also provide auto detailing and restoration services for classic cars. Whether you're looking to get your car repaired after an accident or want to restore your classic ride to its former glory, we're here to help.
The reviewers laud the exceptional customer service, attention to detail, speed, and personalized care provided by the staff at Collision Rescue.
4.6
Based on 142 reviews
Profile Website Phone
Knapp Auto Repair

Knapp Auto Repair

knappautorepair.com
Knapp Auto Repair, formerly Quick Stop Auto Repair, is a locally owned and operated auto repair shop in Dallas, TX, offering a wide range of services, including transmission work, tune-ups, vehicle maintenance, and more, with a team of ASE Certified Technicians and a commitment to 100% customer satisfaction.
Honest, friendly, and professional service from the owner and staff, with attention to detail and efficient repairs.
Some issues with availability and pricing, and a few negative experiences with staff members.
4.5
Based on 236 reviews
Profile Website Phone
Flores Muffler & Radiator

Flores Muffler & Radiator

floresmufflerandradiator.com
Flores Muffler & Radiator is a family-owned and operated auto repair shop that has been providing Dallas and Fort Worth with outstanding auto repairs for over 25 years. Our team of experts offers a range of services, including exhaust systems, mufflers, catalytic converters, radiators, and condensers, and we pride ourselves on our friendly, affordable service that you can trust.
Reviewers praised Flores Muffler for its fair pricing, excellent customer service, and quality work.
4.5
Based on 164 reviews
Profile Website Phone
B.N. Automotive

B.N. Automotive

bnautodallas.com
At B.N. Automotive, we specialize in providing foolproof repair and electrical solutions for all makes and models. Our team of seasoned auto specialists has been in business for more than 30 years, and we pride ourselves on being the best people to handle any car issue. With a reputation for unmatched customer service, we strive to create maximum efficiency for your beloved vehicle. Our services include brake repairs, oil changes, engine repairs, transmission repairs, radiator services, steering, suspension, air conditioning, tune-ups, batteries, and complete preventive maintenance. We also offer state inspections and electrical diagnostic and repairs.
Honest and professional service, fair pricing, and knowledgeable staff.
Overcharging, misleading quotes, and taking advantage of customers, especially women.
4.5
Based on 60 reviews
Profile Website Phone
AAMCO Transmissions

AAMCO Transmissions

aamcodallastx.com
AAMCO Dallas TX proudly serves locals and visitors with impressive transmission and automotive repairs and service in Dallas, TX. Our auto repairs and transmission solutions are carried out by highly skilled technicians with ample experience performing repairs, rebuilds, and total car care. We are a proud member of the AAMCO family, a nationally recognized automotive care authority. Our technicians perform each service with expert precision while pinpointing your transmission issue's specific cause using our exclusive multi-point transmission scan. This technology ensures we get your vehicle back on the road quickly. Whether you're a traveler or a longtime resident, you can take advantage of our professional automotive expertise and services. We complete every transmission repair with thorough workmanship, so you can rest easy knowing your vehicle runs safely. Learn More Learn More About Our Services.
The staff at Aamco are highly praised for their knowledge, caring attitude, and professionalism, leading to excellent customer service and quality of work.
One reviewer had a negative experience, citing unprofessional communication and a focus on profit over customer satisfaction.
4.4
Based on 354 reviews
Profile Website Phone
Luis Transmission

Luis Transmission

luistransmissions.com
Luis Transmissions is a family owned and operated transmission repair center located in Dallas, TX, serving the greater DFW area. With over 20 years of experience, we provide our customers with affordable pricing, expert service, and reliable workmanship. Our team of highly qualified technicians uses the latest technology and diagnostic equipment to accurately diagnose and repair transmission problems. We pride ourselves on providing honest and reliable service, ensuring that our customers receive the level of expertise and attention to detail they deserve. Whether you need manual transmission repair, transmission rebuild, or transmission repair, we've got you covered. With a focus on customer satisfaction, we strive to build long-term relationships with our customers and provide them with a comprehensive range of transmission repair and maintenance services.
The dealership has a strong reputation for providing excellent customer service, honesty, and transparency, with many reviewers praising Luis and other employees for their help and expertise.
The dealership has received negative reviews for poor workmanship, unhelpful service, and rude treatment from employees, particularly Luis.
4.3
Based on 140 reviews
Profile Website Phone
Walker Auto Body & Frame Shop

Walker Auto Body & Frame Shop

walkerautobody.com
Welcome to Walker Auto Body & Frame Shop, a family-owned and operated auto repair shop in Dallas, Texas. We specialize in collision, frame work, detailing, and paint of all makes and models. Our expert mechanics are focused on providing quality repairs for any foreign and domestic vehicles. We are committed to providing honest and reliable vehicle repairs with exceptional customer service at reasonable prices. We offer a lifetime warranty on repairs and a written guarantee on workmanship.
Many customers have reported having a positive experience with Walker Auto Body & Frame Shop, praising the fast and friendly service, the helpfulness of the staff, and the quality of the repairs.
Some customers have reported having a negative experience with Walker Auto Body & Frame Shop, citing issues with missing belongings, poor customer service, and unfulfilled promises.
4.3
Based on 105 reviews
Profile Website Phone
Allstate Transmission Of Dallas

Allstate Transmission Of Dallas

allstatetransmissiondallas.com
Allstate Transmission of Dallas offers top-notch auto repair services, including transmission services, engine and transmission, brakes, engine maintenance, and car and truck care. Our certified mechanics and highly skilled auto repair specialists provide expert auto repairs at an affordable price, with a goal of building long-term relationships with our customers.
Excellent customer service, expertise, and quality of work were consistently praised by many satisfied customers.
One customer reported a very negative experience with Matt, citing unprofessionalism, dishonesty, and poor customer service.
4.2
Based on 40 reviews
Profile Website Phone
Otobots

Otobots

otobots.com
Otobots is a mobile car repair service that offers a range of services, including oil changes, brake repairs, and pre-purchase inspections. Our team of certified technicians will come to you and perform the repairs at a time and place that is convenient for you. We offer a 12-month/12,000-mile warranty on all of our services. With Otobots, you can get the repairs you need without having to leave your home or office. Our team is dedicated to providing excellent customer service and ensuring that you are satisfied with your experience.
Customers who had positive experiences praised the professionalism, knowledge, and affordability of the services.
Many customers were unhappy with the quality of work, professionalism, and customer service.
N/A
Not rated yet
Profile Website Phone
5 Star European Auto

5 Star European Auto

5stareuropeanautoinc.com
5 Star European Auto Body & Repair is a family-owned and operated business specializing in European car repairs and service. With over 15 years of experience, our team of certified professionals provides exceptional service, commitment to quality, and timely and efficient work. We offers a range of services, including mechanical work, auto body repairs, and collision services, using computerized diagnostic checks and advanced technology. Our shop is licensed, insured, and ASE-certified, guaranteeing all work performed with a one-year or 12,000-mile warranty.
N/A
Not rated yet
Profile Website Phone
TX Prestige Auto

TX Prestige Auto

txprestigeauto.com
TX Prestige Auto Co. is a comprehensive automotive collision repair shop that provides a full range of auto body and collision repair services in Dallas, TX. We are dedicated to providing excellent workmanship, prompt service, and exceptional customer care. Our skilled technicians use the latest technology and equipment to ensure that every vehicle is restored to its pre-accident condition. From minor touch-ups to major repairs, we strive to exceed our customers' expectations. With years of experience and a commitment to quality, we are confident that you will be satisfied with our services.
N/A
Not rated yet
Profile Website Phone
National Glass Experts

National Glass Experts

nationalglassexperts.com
National Glass Experts is a leading auto glass repair and replacement service provider, offering a wide range of services including windshield replacement, auto door window repair, and truck glass repair. Our team of experts uses the latest technology to ensure precision and quality in every repair and replacement job. We understand the importance of timely and reliable services, which is why we offer same-day auto glass services, free mobile windshield installation, and a lifetime warranty on our work.
N/A
Not rated yet
Profile Website Phone
Brake & Muffler Stop

Brake & Muffler Stop

brakestopdallas.com
Brake Stop is a trusted and expert automotive repair service based in Dallas, TX, offering a range of services including brake repair, front end alignment, wheel alignment, timing belt replacement, auto tune-ups, and more. Our team of professionals is dedicated to providing top-notch service and ensuring the safety and reliability of your vehicle on the road. With a focus on prompt and efficient repair work, we cater to various types of brake repairs, from brake pad replacements to fluid flushing, to ensure optimal braking performance. Whether you're in need of routine maintenance or emergency repairs, our expert technicians are here to help.
The shop is praised for its honesty, kindness, and quick service, with customers feeling comfortable and trusting the staff with their vehicles.
The phone system is not functional, with no one answering the phone and the mailbox not set up.
N/A
Not rated yet
Profile Website Phone
Locomotion Transmission

Locomotion Transmission

dallastransmissionrepair.org
Locomotion Transmission is a reputable transmission repair shop located in Dallas, TX. We provide high-quality transmission repair, rebuilding, and replacement services to get your vehicle back on the road quickly. Our expert mechanics are dedicated to providing excellent customer service and ensuring that all repairs are done with precision and accuracy. Whether your car is in need of a minor fix or an extensive overhaul, we'll give your vehicle our full attention until it's running like new. Our goal is to establish long-term relationships with our customers by offering affordable auto repair services, accurate estimates and turnarounds, comprehensive repairs, and convenient appointments and scheduling.
N/A
Not rated yet
Profile Website Phone
Rico & Sons Automotive

Rico & Sons Automotive

ricoandsons.com
Rico Sons 5 Star Automotive is a locally family owned and operated auto repair facility located in Dallas, TX. We specialize in all types of auto repair services for family cars, local law enforcement agencies, fleet management companies, dealerships and more. Our highly trained, certified technicians provide complete preventative maintenance and repair services, including tire sales and services, 40-point maintenance inspections, and more. With a commitment to providing extremely high-quality auto repair services, we strive to earn your business by making you our priority. Our services include A/C and heater services, brake services, check engine light info, electrical services, engine services, muffler/exhaust services, maintenance services, oil and lube services, transmission repair, and wheel and tire services, among others.
N/A
Not rated yet
Profile Website Phone
Dentwerks

Dentwerks

dentwerkspro.com
Dentwerks Auto Hail Repair is a locally owned and operated business in Dallas, Texas, providing top-notch auto hail repair services to customers in the DFW area. With 24 years of experience in paintless dent repair, our team of professionals handles everything from paintless dent removal to auto body repair, paint correction, bumper repair, car detailing, and window tint. We pride ourselves on transparency, quick turnaround, deductible assistance, free pick up and delivery, and a lifetime warranty. Our goal is to get your vehicle back to its pre-hail condition as quickly and efficiently as possible.
The majority of reviewers had positive experiences with Dentwerks, praising the staff's professionalism and the quality of the work.
Some reviewers had negative experiences, citing confusion and a lack of commitment to fixing their problems.
N/A
Not rated yet
Profile Website Phone
Import Collision

Import Collision

importcollision.com
Import Collision Repair is a one-stop solution for all your vehicle needs, serving the Dallas and FT. Worth area. We specialize in providing high-end services for exotic and luxury vehicles, including collision repair, paintless dent removal, and general cosmetic repair. With a modern state-of-the-art facility and a team of experienced professionals, we strive to provide exceptional service and quality workmanship.
N/A
Not rated yet
Profile Website Phone
Fix Euro Dallas

Fix Euro Dallas

fixeurotransmission.com
FixEuro Transmission is a leading transmission repair service, specializing in fixing transmissions for various European vehicles, including Audi, BMW, and Mercedes Benz. Our experienced team of technicians, led by Joe, has over 20 years of experience in diagnosing and repairing transmissions. We offer diagnostics, road tests, and free estimates on most repairs. Our goal is to provide exceptional customer service and complete repairs in a timely and cost-effective manner.
N/A
Not rated yet
Profile Website Phone
K3S Auto Repair

K3S Auto Repair

k3sautorepair.com
K3S Auto Repair is a premier auto repair shop in Dallas, Texas, offering a complete range of automotive repair services, including routine maintenance, diagnostics, and complex repairs, with a commitment to quality, transparency, and customer satisfaction.
Customers praised the shop's excellent customer service, transparency, and honesty.
Some customers had poor experiences with the shop's communication and quality of work.
N/A
Not rated yet
Profile Website Phone
Mobile Mechanics Dallas

Mobile Mechanics Dallas

mobilemechanicdallas.com
Autoservicio Mobile Mechanic is a reliable and professional mobile mechanic service that provides expert technicians to come to you and repair your vehicle at any location. We offer a range of services, including pre-purchase vehicle inspections, foreign auto repair, and more. Our team is committed to providing top-notch maintenance and repairs, using the latest diagnostic software and tools. With competitive prices and a commitment to customer satisfaction, Autoservicio Mobile Mechanic is the perfect choice for all your automotive needs.
N/A
Not rated yet
Profile Website Phone
C & R Transmission

C & R Transmission

candrtransmissions.com
At C & R Transmissions, we offer a wide range of services to our customers in Dallas, TX. Our team of ASE-certified technicians has over 62 years of combined experience in transmission repair. We specialize in automatic and manual transmissions, as well as other mechanical services. With over 60 years of family ownership, we strive to provide quality service and unparalleled customer care. Whether you need transmission repair, diagnosis, or maintenance, our goal is to help you get back on the road quickly and safely.
N/A
Not rated yet
Profile Website Phone
Mid Cities Auto Glass

Mid Cities Auto Glass

dallasautoglass.net
At Mid Cities Auto Glass, we specialize in providing reliable and efficient auto glass repair services to meet your needs in the Mid Cities area. Our skilled technicians use the appropriate tools and materials to ensure a satisfactory outcome and enhance the longevity and safety of your vehicle's auto glass. We offer a range of services, including windshield repair, replacement, side window repair, side window replacement, and rear window repair.
N/A
Not rated yet
Profile Website Phone
Reyes Glass Group

Reyes Glass Group

reyesglassgroup.com
Reyes Glass Group provides exceptional auto glass repair and replacement services from coast to coast, offering a wide range of services including windshield repair, windshield replacement, door and vent glass replacement, and more. With over 19 years of experience, our team of professional technicians uses the latest technology and equipment to deliver top-quality service at competitive prices. We cater to a wide range of vehicles, from cars and SUVs to trucks and commercial vehicles.
N/A
Not rated yet
Profile Website Phone
AutoNation Collision Center Maple

AutoNation Collision Center Maple

autonationcollisioncenters.com
AutoNation Collision Center is a trusted auto repair shop that offers comprehensive collision repair services, including paintless dent repair, scratch, dent, and ding repair, complete auto paint services, windshield replacement, auto glass repair, and wheel alignment. With over 150 locations throughout the US, AutoNation is dedicated to providing high-quality services, manufacturer-certified repairs, and expedited claims processing for a hassle-free experience.
N/A
Not rated yet
Profile Website Phone
Safe Auto Glass

Safe Auto Glass

safeautoglass.net
Safe Auto Glass is a leading provider of windshield repair and replacement services in the Dallas/Fort Worth Metroplex. With over 18 years of experience, we offer a wide range of services, including windshield, door glass, and back glass replacement, as well as power window repair. Our team of experts is dedicated to providing the best service possible, with a lifetime warranty on installation and labor. Call us today at 214-366-0166 or 817-717-2377 to schedule an appointment or get a free quote.
N/A
Not rated yet
Profile Website Phone
Dent Restorations Of Dallas

Dent Restorations Of Dallas

dentrestorations.com
Dent Restorations of Dallas is a professional auto repair shop specializing in hail damage repair, auto body dent repair, and paintless dent removal. With over 20 years of experience, our expert technicians use specialized tools to massage out minor dents and dings from the back of the panel, minimizing time and cost. We offer a mobile service that comes to your home or office, providing a convenient and hassle-free experience. Our team is dedicated to providing 100% satisfaction and guarantees the quality of our work.
N/A
Not rated yet
Profile Website Phone
Top Notch Image

Top Notch Image

topnotchimage.com
National Hail Team is a premier auto hail repair and paintless dent repair company specializing in hail damage repair for the entire Dallas-Fort Worth Metroplex. Our certified facility is conveniently located in Rowlett, TX, allowing us to offer our services to residents in Dallas, Kaufman, Rockwall, Hunt, Collin, Denton, and Tarrant counties. We pride ourselves on being a 100% comprehensive auto hail damage repair company, offering a range of services from paintless dent repair to traditional paint and body repair methods. Our team of certified technicians is dedicated to providing industry-leading repairs and a hassle-free experience for our customers.
N/A
Not rated yet
Profile Website Phone
Gary Miars Automotive

Gary Miars Automotive

garymiarsautomotive.com
Gary Miars Automotive has been providing quality auto repair services in Addison, Texas for years. Our family-owned business is dedicated to delivering honest, reliable, and professional auto repair and auto maintenance services to the people of Addison and surrounding areas. Our team of ASE-certified technicians employs the latest automotive technology and is equipped to handle all major and minor repairs on foreign and domestic vehicles. We offer a wide range of services, including general maintenance, exhaust system repair, air conditioning service, axle repair, brake repair, oil changes, and more. At Gary Miars Automotive, we take pride in our ability to provide excellent customer service and support, ensuring that our customers receive the best possible experience from start to finish.
N/A
Not rated yet
Profile Website Phone
Louden Motorcar Services

Louden Motorcar Services

loudenmotorcars.com
At Louden Motorcar Services, Inc., we have been a trusted and authorized Bosch service center since 1986, serving the German automobile community in Dallas, Coppell, Highland Park, Irving, and University Park. Our ASE-certified technicians are masters in their craft, with over 40 years of experience in providing top-notch service and repair for BMW, Mercedes, MINI, and Porsche vehicles. Our state-of-the-art facility is equipped with the latest factory-grade tools and equipment, ensuring that we can provide specialist-level services for all models of these luxury cars. Whether you're in need of routine maintenance, repairs, or diagnostics, our friendly and knowledgeable staff is committed to providing you with award-winning quality and exceptional customer service.
The majority of customers have had excellent experiences with Louden Motorcar Services, praising their professionalism, courtesy, and expertise.
N/A
Not rated yet
Profile Website Phone